For quotations, please use our online quotation form, and you may also contact us by
sales@neoscientific.com
+1-888.733.6849
+1-617.299.7367 (Int’l)
+1-888.733.6849
+1-617.299.7367 (Int’l)
| Introduction | The Endonuclease catalyzes the hydrolysis of both DNA and RNA, double or single stranded, at position 3' of the phosphodiester bond to generate 5'-phosphorylated mono-, di-, tri- and tetranucleotides (DNA being the slightly better substrate than RNA). Endonuclease binds one magnesium ion as cofactor. Endonuclease active site contains one hydrated magnesium ion which has only one direct interaction with the protein, while all the other interactions are via water molecules. |
| Synonyms | NULL |
| Source | E.coli. |
| Physical Appearance | Sterile Filtered colorless solution. |
| Formulation | The Endonuclease solution contains 50mM Tris-HCl pH 8.0, 20mM NaCl, 2mM MgCl2 and 50% glycerol. |
| Stability | Store at 4°C if entire vial will be used within 2-4 weeks.Store, frozen at -20°C for longer periods of time.Storage at lower than -200C can results in loss of activity.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles. |
| Amino Acid Sequence | ADTLESIDNCAVGCPTGGSSNVSIVRHAYTLNNNSTTKFANWVAYHITKDTPASGKTRNWKTDPALNPADTLAPADYTGANAALKVDRGHQAPLASLAGVSDWESLNYLSNITPQKSDLNQGAWARLEDQERKLIDRADISSVYTVTGPLYERDMGKLPGTQKAHTIPSAYWKVIFINNSPAVNHYAAFLFDQNTPKGADFCQFRVTVDEIEKRTGLIIWAGLPDDVQASLKSKPASCRS |
| Purity | Greater than 90% as determined by SDS-PAGE, under reducing conditions. |
| Usage | NeoScientific's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drµgs, agricultural or pesticidal products, food additives or household chemicals. |
N/A
N/A