For quotations, please use our online quotation form, and you may also contact us by
sales@neoscientific.com
+1-888.733.6849
+1-617.299.7367 (Int’l)
+1-888.733.6849
+1-617.299.7367 (Int’l)
| Introduction | Eotaxin-2, also called MPIF2 & Ckb6, is a novel CC chemokine produced by activated monocytes and T lymphocytes. Eotaxin-2 selectively chemoattracts cells expressing CCR3 including eosinophils, basophils, Th2 T cells, mast cells, and certain subsets of dendritic cells. Furthermore, Eotaxin-2 inhibits the proliferation of multipotential hematopoietic progenitor cells. The mature protein, which includes C-terminal truncation, contains 78 amino acids (92 amino acids for the mouse homolog, without C-terminal truncation).CCL24 functions as a chemotactic chemokine for resting t-lymphocytes, and eosinophils. CCL24 has lower chemotactic activity for neutrophils but none for monocytes and activated lymphocytes. CCL24 is a strong suppressor of colony formation by a multipotential hematopoietic progenitor cell line and binds to CCR3. |
| Synonyms | C-C motif chemokine 24, Small-inducible cytokine A24, Myeloid progenitor inhibitory factor 2, CK-beta-6, Eosinophil chemotactic protein 2, Eotaxin-2, CCL24, Ckb-6, MPIF2, MPIF-2, SCYA24, Eotaxin2, CCL-24. |
| Source | Escherichia Coli. |
| Physical Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Formulation | The CCL24 protein was lyophilized from a concentrated (1mg/ml) sterile solution containing 20mM PBS pH-7.4 and 0.15M sodium chloride. |
| Solubility | It is recommended to reconstitute the lyophilized CCL24 Human Recombinant in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions. |
| Stability | Lyophilized Eotaxin-2 althoµgh stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CCL24 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles. |
| Amino Acid Sequence | VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKGGVIFTTKKGQQFCGDPKQEWV QRYMKNLDAKQKKASPRARAVA. |
| Purity | Greater than 97.0% as determined by(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
| Biological Activity | The activity is determined by the chemoattract of human PBE (peripheral blood eosinophils) at a concentration between 50-100 ng/ml corresponding to a Specific Activity of 10,000-20,000IU/mg. |
| Usage | NeoScientific products are furnished for LABORATORY RESEARCH USE ONLY. The products may not be used as drµgs, agricultural or pesticidal products, food additives or household chemicals. |
N/A
N/A