For quotations, please use our online quotation form, and you may also contact us by
sales@neoscientific.com
+1-888.733.6849
+1-617.299.7367 (Int’l)
+1-888.733.6849
+1-617.299.7367 (Int’l)
| Introduction | Hepatitis B virus (HBV) is a human pathogen, causing serious liver disease. The HBV surface protein antigens (HBsAg) are comprised of three carboxyl co terminal HBs proteins termed large (LHBs), middle (MHBs) and small (SHBs, also called major) protein. LHBs and MHBs also share the highly hydrophobic, repetitive, membrane spanning S domain. In addition, MHBs has a 55 amino acid region called preS2. |
| Synonyms | NULL |
| Source | NULL |
| Formulation | HBsAg protein was lyophilized from 0.2μm filtered (1mg/ml) solution in 20mM PB, pH 7.4 and 50mM NaCl. |
| Solubility | We recommend that this vial be briefly centrifµged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions. |
| Amino Acid Sequence | MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPN. |
| Purity | HBsAg protein is >95% pure as determined by 10% PAGE (coomassie staining). |
| Applications | 1. Immunochromatography (capture and conjµgate).2. Preparing monoclonal or polyclonal antibodies for HBsAg-preS2. 3. ELISA. |
| Storage | This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles. |
| Purification Method | HBsAg protein was purified by proprietary chromatographic technique. |
N/A
N/A