Accelerate Your Biomolecule
and Bioassay Research
and Bioassay Research
sales@neoscientific.com
+1-888.733.6849
+1-617.299.7367 (Int’l)
+1-617.299.7367 (Int’l)
+1-888.733.6849
+1-617.299.7367 (Int’l)
+1-617.299.7367 (Int’l)
For quotations, please use our online quotation form, and you may also contact us by
sales@neoscientific.com
+1-888.733.6849
+1-617.299.7367 (Int’l)
+1-888.733.6849
+1-617.299.7367 (Int’l)
| Introduction | Hepatocyte Growth Factor (HGF) is a multifunctional growth factor which regulates both cell growth and cell motility. It exerts a strong mitogenic effect on hepatocytes and primary epithelial cells. HGF synergizes with Interleukin-3 and GM-CSF to stimulate colony formation of hematopoietic progenitor cells in vitro and may, therefore, also modulate hematopoiesis. HGF is secreted as a single inactive polypeptide which is cleaved by serine proteases into a 69kDa Alpha chain and 34kDa Beta chain. A disulfide bond linking the alpha and beta chains produces the active heterodimeric molecule. |
| Synonyms | Scatter Factor, SF, Hepatopoietin, HPTA, HGF, HGFB, F-TCF, DFNB39, Hepatocyte growth factor, Hepatocyte growth factor beta chain. |
| Source | Escherichia Coli. |
| Physical Appearance | Sterile Filtered clear solution. |
| Formulation | HGF-B protein is supplied in 10mM TrisHCI (pH.8), 50% glycerol |
| Stability | Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. Please avoid freeze thaw cycles. |
| Amino Acid Sequence | VVNGIPTRTNIGWMVSLRYRNKHICGGSLIKESWVLTARQCFPSRDLKDYEAWLGIHDVHGRGDEKCKQVLNVSQLVYGPEGSDLVLMKLARPAVLDDFVSTIDLPNYGCTIPEKTSCSVYGWGYTGLINYDGLLRVAHLYIMGNEKCSQHHRGKVTLNESEICAGAEKIGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKIILTYKVPQS. |
| Purity | Greater than 95.0% as determined by SDS-PAGE. |
| Usage | NeoScientific's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drµgs, agricultural or pesticidal products, food additives or household chemicals. |
N/A
N/A
Copyrights © 2014 NEO Group 245 First Street, 18th Floor, Cambridge MA 02142 888.733.6849
